PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G33860.1
Common NameARF3, ETT, T1B8.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 608aa    MW: 66605.6 Da    PI: 6.9737
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G33860.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.52.9e-24159260199
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  f+k+lt sd++++g +++p++ ae++      ++++ s++l  +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + ++++l+
  AT2G33860.1 159 FCKTLTASDTSTHGGFSVPRRAAEDCfppldYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGDDGKLR 254
                  99****************************955566778*************************************************..3489999* PP

                  EEEE-S CS
           B3  94 vkvfrk 99 
                  ++v+r+
  AT2G33860.1 255 LGVRRA 260
                  ***997 PP

2Auxin_resp111.67.7e-37285366182
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                  +aha+st+svF++ YnP+as+s+F++++ k++k ++ ++++GmRfk ++e+ed+serr  G+++g+sdldp+rWp+SkWr+L
  AT2G33860.1 285 VAHAISTHSVFSISYNPKASWSNFIIPAPKFLKVVDYPFCIGMRFKARVESEDASERRSPGIISGISDLDPIRWPGSKWRCL 366
                  79*******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019369.55E-43149287IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.1E-39153268IPR015300DNA-binding pseudobarrel domain
CDDcd100175.87E-22157259No hitNo description
PfamPF023623.5E-22159260IPR003340B3 DNA binding domain
PROSITE profilePS5086313.324159261IPR003340B3 DNA binding domain
SMARTSM010191.9E-22159261IPR003340B3 DNA binding domain
PfamPF065073.3E-30285366IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009850Biological Processauxin metabolic process
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0015031Biological Processprotein transport
GO:0016192Biological Processvesicle-mediated transport
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0005525Molecular FunctionGTP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000017anatomyvascular leaf primordium
PO:0000037anatomyshoot apex
PO:0000229anatomyflower meristem
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020003anatomyplant ovule
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0020144anatomyapical meristem
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007130developmental stagesporophyte reproductive stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MGGLIDLNVM ETEEDETQTQ TPSSASGSVS PTSSSSASVS VVSSNSAGGG VCLELWHACA  60
GPLISLPKRG SLVLYFPQGH LEQAPDFSAA IYGLPPHVFC RILDVKLHAE TTTDEVYAQV  120
SLLPESEDIE RKVREGIIDV DGGEEDYEVL KRSNTPHMFC KTLTASDTST HGGFSVPRRA  180
AEDCFPPLDY SQPRPSQELL ARDLHGLEWR FRHIYRGQPR RHLLTTGWSA FVNKKKLVSG  240
DAVLFLRGDD GKLRLGVRRA SQIEGTAALS AQYNQNMNHN NFSEVAHAIS THSVFSISYN  300
PKASWSNFII PAPKFLKVVD YPFCIGMRFK ARVESEDASE RRSPGIISGI SDLDPIRWPG  360
SKWRCLLVRW DDIVANGHQQ RVSPWEIEPS GSISNSGSFV TTGPKRSRIG FSSGKPDIPV  420
SEGIRATDFE ESLRFQRVLQ GQEIFPGFIN TCSDGGAGAR RGRFKGTEFG DSYGFHKVLQ  480
GQETVPAYSI TDHRQQHGLS QRNIWCGPFQ NFSTRILPPS VSSSPSSVLL TNSNSPNGRL  540
EDHHGGSGRC RLFGFPLTDE TTAVASATAV PCVEGNSMKG ASAVQSNHHH SQGRDIYAMR  600
DMLLDIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-109433967361Auxin response factor 1
4ldw_A1e-109433967361Auxin response factor 1
4ldw_B1e-109433967361Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.103600.0flower| root| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453605860.0
Genevisible267452_at0.0
Expression AtlasAT2G33860-
AtGenExpressAT2G33860-
ATTED-IIAT2G33860-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected during gynoecium development.
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078, ECO:0000269|PubMed:9409666}.
Functional Description ? help Back to Top
Source Description
TAIRettin (ett) mutations have pleiotropic effects on Arabidopsis flower development, causing increases in perianth organ number, decreases in stamen number and anther formation, and apical-basal patterning defects in the gynoecium. The ETTIN gene encodes a protein with homology to DNA binding proteins which bind to auxin response elements. ETT transcript is expressed throughout stage 1 floral meristems and subsequently resolves to a complex pattern within petal, stamen and carpel primordia. ETT probably functions to impart regional identity in floral meristems that affects perianth organ number spacing, stamen formation, and regional differentiation in stamens and the gynoecium. During stage 5, ETT expression appears in a ring at the top of the floral meristem before morphological appearance of the gynoecium, consistent with the proposal that ETT is involved in prepatterning apical and basal boundaries in the gynoecium primordium. It is a target of the ta-siRNA tasiR-ARF.
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Involved in the establishment or elaboration of tissue patterning during gynoecial development. {ECO:0000269|PubMed:10952886, ECO:0000269|PubMed:12036261}.
Function -- GeneRIF ? help Back to Top
  1. Mutations in ETTIN were isolated as second site suppressors and found to ameliorate ectopic KANADI activity throughout the plant as well. Mutant phenotypes of ett are restricted to flowers.
    [PMID: 16199616]
  2. Mutations delay the expression of adult traits, demonstrating that these genes have non-redundant roles in shoot maturation.
    [PMID: 16818444]
  3. ATS and ETT were found to share an overlapping expression pattern during Arabidopsis ovule development and loss of either gene resulted in congenital fusion of the integuments and altered seed morphology.
    [PMID: 22296848]
  4. Auxin Response Factor 3 (ARF3) was identified as a mediator of cross-talk between self-incompatibility signaling and pistil development.
    [PMID: 23129621]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBM24477691Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G33860.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by AHL21/GIK. {ECO:0000269|PubMed:19956801}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G65620 (R), AT2G37630 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G45190(A), AT4G36930(R), AT5G20930(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G33860, AT5G42630
IntActSearch O23661
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G33860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3603130.0AF360313.1 Arabidopsis thaliana auxin response transcription factor 3 (ETTIN/ARF3) (At2g33860) mRNA, complete cds.
GenBankAY0563650.0AY056365.1 Arabidopsis thaliana auxin response transcription factor 3 (At2g33860) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180942.10.0auxin response transcription factor 3
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLR0G0L10.0R0G0L1_9BRAS; Auxin response factor
STRINGAT2G33860.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49242849
Representative plantOGRP66851018
Publications ? help Back to Top
  1. Bowman JL,Baum SF,Eshed Y,Putterill J,Alvarez J
    Molecular genetics of gynoecium development in Arabidopsis.
    Curr. Top. Dev. Biol., 1999. 45: p. 155-205
    [PMID:10332605]
  2. Ulmasov T,Hagen G,Guilfoyle TJ
    Dimerization and DNA binding of auxin response factors.
    Plant J., 1999. 19(3): p. 309-19
    [PMID:10476078]
  3. Nemhauser JL,Feldman LJ,Zambryski PC
    Auxin and ETTIN in Arabidopsis gynoecium morphogenesis.
    Development, 2000. 127(18): p. 3877-88
    [PMID:10952886]
  4. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  5. Heisler MG,Atkinson A,Bylstra YH,Walsh R,Smyth DR
    SPATULA, a gene that controls development of carpel margin tissues in Arabidopsis, encodes a bHLH protein.
    Development, 2001. 128(7): p. 1089-98
    [PMID:11245574]
  6. Sato Y, et al.
    Auxin response factor family in rice.
    Genes Genet. Syst., 2001. 76(6): p. 373-80
    [PMID:11922106]
  7. Hagen G,Guilfoyle T
    Auxin-responsive gene expression: genes, promoters and regulatory factors.
    Plant Mol. Biol., 2002 Jun-Jul. 49(3-4): p. 373-85
    [PMID:12036261]
  8. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  9. Nishimura T,Wada T,Okada K
    A key factor of translation reinitiation, ribosomal protein L24, is involved in gynoecium development in Arabidopsis.
    Biochem. Soc. Trans., 2004. 32(Pt 4): p. 611-3
    [PMID:15270688]
  10. Pfluger J,Zambryski P
    The role of SEUSS in auxin response and floral organ patterning.
    Development, 2004. 131(19): p. 4697-707
    [PMID:15358669]
  11. Okushima Y, et al.
    Functional genomic analysis of the AUXIN RESPONSE FACTOR gene family members in Arabidopsis thaliana: unique and overlapping functions of ARF7 and ARF19.
    Plant Cell, 2005. 17(2): p. 444-63
    [PMID:15659631]
  12. Williams L,Carles CC,Osmont KS,Fletcher JC
    A database analysis method identifies an endogenous trans-acting short-interfering RNA that targets the Arabidopsis ARF2, ARF3, and ARF4 genes.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(27): p. 9703-8
    [PMID:15980147]
  13. Nakayama N, et al.
    Gene trap lines define domains of gene regulation in Arabidopsis petals and stamens.
    Plant Cell, 2005. 17(9): p. 2486-506
    [PMID:16055634]
  14. Pekker I,Alvarez JP,Eshed Y
    Auxin response factors mediate Arabidopsis organ asymmetry via modulation of KANADI activity.
    Plant Cell, 2005. 17(11): p. 2899-910
    [PMID:16199616]
  15. Nishimura T,Wada T,Yamamoto KT,Okada K
    The Arabidopsis STV1 protein, responsible for translation reinitiation, is required for auxin-mediated gynoecium patterning.
    Plant Cell, 2005. 17(11): p. 2940-53
    [PMID:16227452]
  16. Adenot X, et al.
    DRB4-dependent TAS3 trans-acting siRNAs control leaf morphology through AGO7.
    Curr. Biol., 2006. 16(9): p. 927-32
    [PMID:16682354]
  17. Garcia D,Collier SA,Byrne ME,Martienssen RA
    Specification of leaf polarity in Arabidopsis via the trans-acting siRNA pathway.
    Curr. Biol., 2006. 16(9): p. 933-8
    [PMID:16682355]
  18. Fahlgren N, et al.
    Regulation of AUXIN RESPONSE FACTOR3 by TAS3 ta-siRNA affects developmental timing and patterning in Arabidopsis.
    Curr. Biol., 2006. 16(9): p. 939-44
    [PMID:16682356]
  19. Sohlberg JJ, et al.
    STY1 regulates auxin homeostasis and affects apical-basal patterning of the Arabidopsis gynoecium.
    Plant J., 2006. 47(1): p. 112-23
    [PMID:16740145]
  20. Hunter C, et al.
    Trans-acting siRNA-mediated repression of ETTIN and ARF4 regulates heteroblasty in Arabidopsis.
    Development, 2006. 133(15): p. 2973-81
    [PMID:16818444]
  21. Nakazawa Y,Hiraguri A,Moriyama H,Fukuhara T
    The dsRNA-binding protein DRB4 interacts with the Dicer-like protein DCL4 in vivo and functions in the trans-acting siRNA pathway.
    Plant Mol. Biol., 2007. 63(6): p. 777-85
    [PMID:17221360]
  22. Iwakawa H, et al.
    Expression of the ASYMMETRIC LEAVES2 gene in the adaxial domain of Arabidopsis leaves represses cell proliferation in this domain and is critical for the development of properly expanded leaves.
    Plant J., 2007. 51(2): p. 173-84
    [PMID:17559509]
  23. Filichkin SA, et al.
    Efficiency of gene silencing in Arabidopsis: direct inverted repeats vs. transitive RNAi vectors.
    Plant Biotechnol. J., 2007. 5(5): p. 615-26
    [PMID:17573806]
  24. Gremski K,Ditta G,Yanofsky MF
    The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.
    Development, 2007. 134(20): p. 3593-601
    [PMID:17855426]
  25. Meng C,Chen J,Ding SW,Peng J,Wong SM
    Hibiscus chlorotic ringspot virus coat protein inhibits trans-acting small interfering RNA biogenesis in Arabidopsis.
    J. Gen. Virol., 2008. 89(Pt 9): p. 2349-58
    [PMID:18753245]
  26. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  27. Usami T,Horiguchi G,Yano S,Tsukaya H
    The more and smaller cells mutants of Arabidopsis thaliana identify novel roles for SQUAMOSA PROMOTER BINDING PROTEIN-LIKE genes in the control of heteroblasty.
    Development, 2009. 136(6): p. 955-64
    [PMID:19211679]
  28. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  29. Inagaki S,Nakamura K,Morikami A
    A link among DNA replication, recombination, and gene expression revealed by genetic and genomic analysis of TEBICHI gene of Arabidopsis thaliana.
    PLoS Genet., 2009. 5(8): p. e1000613
    [PMID:19696887]
  30. Ikezaki M, et al.
    Genetic networks regulated by ASYMMETRIC LEAVES1 (AS1) and AS2 in leaf development in Arabidopsis thaliana: KNOX genes control five morphological events.
    Plant J., 2010. 61(1): p. 70-82
    [PMID:19891706]
  31. Ng KH,Yu H,Ito T
    AGAMOUS controls GIANT KILLER, a multifunctional chromatin modifier in reproductive organ patterning and differentiation.
    PLoS Biol., 2009. 7(11): p. e1000251
    [PMID:19956801]
  32. Yoon EK, et al.
    Auxin regulation of the microRNA390-dependent transacting small interfering RNA pathway in Arabidopsis lateral root development.
    Nucleic Acids Res., 2010. 38(4): p. 1382-91
    [PMID:19969544]
  33. Ng KH,Ito T
    Shedding light on the role of AT-hook/PPC domain protein in Arabidopsis thaliana.
    Plant Signal Behav, 2010. 5(2): p. 200-1
    [PMID:20173412]
  34. Groszmann M,Bylstra Y,Lampugnani ER,Smyth DR
    Regulation of tissue-specific expression of SPATULA, a bHLH gene involved in carpel development, seedling germination, and lateral organ growth in Arabidopsis.
    J. Exp. Bot., 2010. 61(5): p. 1495-508
    [PMID:20176890]
  35. Marin E, et al.
    miR390, Arabidopsis TAS3 tasiRNAs, and their AUXIN RESPONSE FACTOR targets define an autoregulatory network quantitatively regulating lateral root growth.
    Plant Cell, 2010. 22(4): p. 1104-17
    [PMID:20363771]
  36. Finet C, et al.
    Parallel structural evolution of auxin response factors in the angiosperms.
    Plant J., 2010. 63(6): p. 952-9
    [PMID:20626651]
  37. Kojima S, et al.
    Asymmetric leaves2 and Elongator, a histone acetyltransferase complex, mediate the establishment of polarity in leaves of Arabidopsis thaliana.
    Plant Cell Physiol., 2011. 52(8): p. 1259-73
    [PMID:21700721]
  38. Vernoux T, et al.
    The auxin signalling network translates dynamic input into robust patterning at the shoot apex.
    Mol. Syst. Biol., 2011. 7: p. 508
    [PMID:21734647]
  39. Li W, et al.
    DNA methylation and histone modifications regulate de novo shoot regeneration in Arabidopsis by modulating WUSCHEL expression and auxin signaling.
    PLoS Genet., 2011. 7(8): p. e1002243
    [PMID:21876682]
  40. Kelley DR,Arreola A,Gallagher TL,Gasser CS
    ETTIN (ARF3) physically interacts with KANADI proteins to form a functional complex essential for integument development and polarity determination in Arabidopsis.
    Development, 2012. 139(6): p. 1105-9
    [PMID:22296848]
  41. Moschopoulos A,Derbyshire P,Byrne ME
    The Arabidopsis organelle-localized glycyl-tRNA synthetase encoded by EMBRYO DEFECTIVE DEVELOPMENT1 is required for organ patterning.
    J. Exp. Bot., 2012. 63(14): p. 5233-43
    [PMID:22791832]
  42. Cheng ZJ, et al.
    Pattern of auxin and cytokinin responses for shoot meristem induction results from the regulation of cytokinin biosynthesis by AUXIN RESPONSE FACTOR3.
    Plant Physiol., 2013. 161(1): p. 240-51
    [PMID:23124326]
  43. Tantikanjana T,Nasrallah JB
    Non-cell-autonomous regulation of crucifer self-incompatibility by Auxin Response Factor ARF3.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(47): p. 19468-73
    [PMID:23129621]
  44. Rosado A,Li R,van de Ven W,Hsu E,Raikhel NV
    Arabidopsis ribosomal proteins control developmental programs through translational regulation of auxin response factors.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(48): p. 19537-44
    [PMID:23144218]
  45. Ishibashi N, et al.
    ASYMMETRIC-LEAVES2 and an ortholog of eukaryotic NudC domain proteins repress expression of AUXIN-RESPONSE-FACTOR and class 1 KNOX homeobox genes for development of flat symmetric leaves in Arabidopsis.
    Biol Open, 2012. 1(3): p. 197-207
    [PMID:23213410]
  46. Takahashi H, et al.
    Meta-analyses of microarrays of Arabidopsis asymmetric leaves1 (as1), as2 and their modifying mutants reveal a critical role for the ETT pathway in stabilization of adaxial-abaxial patterning and cell division during leaf development.
    Plant Cell Physiol., 2013. 54(3): p. 418-31
    [PMID:23396601]
  47. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  48. Iwasaki M, et al.
    Dual regulation of ETTIN (ARF3) gene expression by AS1-AS2, which maintains the DNA methylation level, is involved in stabilization of leaf adaxial-abaxial partitioning in Arabidopsis.
    Development, 2013. 140(9): p. 1958-69
    [PMID:23571218]
  49. Xing S, et al.
    SPL8 and miR156-targeted SPL genes redundantly regulate Arabidopsis gynoecium differential patterning.
    Plant J., 2013. 75(4): p. 566-77
    [PMID:23621152]
  50. Boer DR, et al.
    Structural basis for DNA binding specificity by the auxin-dependent ARF transcription factors.
    Cell, 2014. 156(3): p. 577-89
    [PMID:24485461]
  51. Liu X, et al.
    AUXIN RESPONSE FACTOR 3 integrates the functions of AGAMOUS and APETALA2 in floral meristem determinacy.
    Plant J., 2014. 80(4): p. 629-41
    [PMID:25187180]
  52. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  53. Sessions RA,Zambryski PC
    Arabidopsis gynoecium structure in the wild and in ettin mutants.
    Development, 1995. 121(5): p. 1519-32
    [PMID:7789281]
  54. Roe JL,Nemhauser JL,Zambryski PC
    TOUSLED participates in apical tissue formation during gynoecium development in Arabidopsis.
    Plant Cell, 1997. 9(3): p. 335-53
    [PMID:9090879]
  55. Ulmasov T,Hagen G,Guilfoyle TJ
    ARF1, a transcription factor that binds to auxin response elements.
    Science, 1997. 276(5320): p. 1865-8
    [PMID:9188533]
  56. Sessions A, et al.
    ETTIN patterns the Arabidopsis floral meristem and reproductive organs.
    Development, 1997. 124(22): p. 4481-91
    [PMID:9409666]